![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
![]() | Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
![]() | Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries) |
![]() | Domain d5gthl_: 5gth L: [344256] Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_ automated match to d3a0hl_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gth (more details), 2.5 Å
SCOPe Domain Sequences for d5gthl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gthl_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]} epnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d5gthl_: