Lineage for d5gthl_ (5gth L:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631727Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2631728Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 2631729Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 2631737Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)
  8. 2631762Domain d5gthl_: 5gth L: [344256]
    Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_
    automated match to d3a0hl_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gthl_

PDB Entry: 5gth (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (dark dataset)
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d5gthl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gthl_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
epnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d5gthl_:

Click to download the PDB-style file with coordinates for d5gthl_.
(The format of our PDB-style files is described here.)

Timeline for d5gthl_: