![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
![]() | Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
![]() | Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (23 PDB entries) |
![]() | Domain d5gtht_: 5gth T: [344260] Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gthu_, d5gthv_, d5gthx_, d5gthz_ automated match to d2axtt1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gth (more details), 2.5 Å
SCOPe Domain Sequences for d5gtht_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gtht_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]} metityvfifaciialfffaiffrepprit
Timeline for d5gtht_: