Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (14 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries) |
Domain d5gtha_: 5gth A: [344248] Other proteins in same PDB: d5gthb_, d5gthc_, d5gthe_, d5gthf_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_ automated match to d2axta1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gth (more details), 2.5 Å
SCOPe Domain Sequences for d5gtha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gtha_ f.26.1.1 (A:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} anlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgs llygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrq welsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaeh nilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniva ahgyfgrlifqyasfnnsrslhfflaawpvvgvwfaalgistmafnlngfnfnhsvidak gnvintwadiinranlgmevmhernahnfpldla
Timeline for d5gtha_: