Lineage for d4qw6r_ (4qw6 R:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2594900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2595460Domain d4qw6r_: 4qw6 R: [344069]
    Other proteins in same PDB: d4qw6a_, d4qw6b_, d4qw6c_, d4qw6f_, d4qw6h_, d4qw6i_, d4qw6j_, d4qw6l_, d4qw6m_, d4qw6n_, d4qw6o_, d4qw6p_, d4qw6q_, d4qw6t_, d4qw6v_, d4qw6w_, d4qw6x_, d4qw6z_
    automated match to d4cr2e_
    complexed with 3bv, cl, mes, mg; mutant

Details for d4qw6r_

PDB Entry: 4qw6 (more details), 2.9 Å

PDB Description: yCP beta5-M45V mutant in complex with carfilzomib
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d4qw6r_:

Sequence, based on SEQRES records: (download)

>d4qw6r_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d4qw6r_ d.153.1.4 (R:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d4qw6r_:

Click to download the PDB-style file with coordinates for d4qw6r_.
(The format of our PDB-style files is described here.)

Timeline for d4qw6r_: