SCOPe 2.07: Domain d4qw6v_: 4qw6 V:

Lineage for d4qw6v_ (4qw6 V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qw6v_: 4qw6 V: [308756]
   Other proteins in same PDB: d4qw6a_, d4qw6c_, d4qw6d_, d4qw6e_, d4qw6g_, d4qw6i_, d4qw6j_, d4qw6k_, d4qw6l_, d4qw6n_, d4qw6o_, d4qw6q_, d4qw6r_, d4qw6s_, d4qw6u_, d4qw6w_, d4qw6x_, d4qw6y_, d4qw6z_
   automated match to d4r17h_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qw6v_

PDB Entry: 4qw6, 2.9 Å

PDB Description: yCP beta5-M45V mutant in complex with carfilzomib

PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qw6v_:

Sequence; same for both SEQRES and ATOM records:

>d4qw6v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

Timeline for d4qw6v_:

• d4qw6v_ first appeared in SCOPe 2.06
  
• d4qw6v_ appears in the current release, SCOPe 2.08