Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qw6p_: 4qw6 P: [308751] Other proteins in same PDB: d4qw6a_, d4qw6c_, d4qw6d_, d4qw6e_, d4qw6g_, d4qw6i_, d4qw6j_, d4qw6k_, d4qw6l_, d4qw6n_, d4qw6o_, d4qw6q_, d4qw6r_, d4qw6s_, d4qw6u_, d4qw6w_, d4qw6x_, d4qw6y_, d4qw6z_ automated match to d1rypc_ complexed with 3bv, cl, mes, mg; mutant |
PDB Entry: 4qw6 (more details), 2.9 Å
SCOPe Domain Sequences for d4qw6p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qw6p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qw6p_: