SCOPe 2.06: Domain d1orob_: 1oro B:

Lineage for d1orob_ (1oro B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Orotate PRTase [53290] (3 species)

7. Species Escherichia coli [TaxId:562] [53292] (1 PDB entry)

8. Domain d1orob_: 1oro B: [34094]
   complexed with so4

Details for d1orob_

PDB Entry: 1oro, 2.4 Å

PDB Description: a flexible loop at the dimer interface is a part of the active site of the adjacent monomer of escherichia coli orotate phosphoribosyltransferase

PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d1orob_:

Sequence, based on SEQRES records:

>d1orob_ c.61.1.1 (B:) Orotate PRTase {Escherichia coli [TaxId: 562]}
mkpyqrqfiefalskqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdldlpycfnrkeakdhgeggnlvgsalqgrv
mlvddvitagtairesmeiiqangatlagvlisldrqergrgeisaiqeverdynckvis
iitlkdliayleekpemaehlaavkayreefgv

Sequence, based on observed residues (ATOM records):

>d1orob_ c.61.1.1 (B:) Orotate PRTase {Escherichia coli [TaxId: 562]}
mkpyqrqfiefalskqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdldlpycfnrkegnlvgsalqgrvmlvddvi
tagtairesmeiiqangatlagvlisldrqergrgeisaiqeverdynckvisiitlkdl
iayleekpemaehlaavkayreefgv

Timeline for d1orob_:

• d1orob_ first appeared (with stable ids) in SCOP 1.55
  
• d1orob_ appears in SCOPe 2.05
  
• d1orob_ appears in SCOPe 2.07
  
• d1orob_ appears in the current release, SCOPe 2.08