SCOPe 2.08: Domain d5wloa_: 5wlo A:

Lineage for d5wloa_ (5wlo A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d5wloa_: 5wlo A: [340788]
   automated match to d1sdta_
   complexed with act, cl, gol, gr7, na

Details for d5wloa_

PDB Entry: 5wlo, 1.27 Å

PDB Description: a novel 13-ring macrocyclic hiv-1 protease inhibitors involving the p1'-p2' ligands

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d5wloa_:

Sequence; same for both SEQRES and ATOM records:

>d5wloa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d5wloa_:

• d5wloa_ first appeared in SCOPe 2.06
  
• d5wloa_ appears in SCOPe 2.07