SCOPe 2.08: Domain d1ao0b1: 1ao0 B:235-459

Lineage for d1ao0b1 (1ao0 B:235-459)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [53279] (2 PDB entries)

8. Domain d1ao0b1: 1ao0 B:235-459 [34050]
   Other proteins in same PDB: d1ao0a2, d1ao0b2, d1ao0c2, d1ao0d2
   complexed with 5gp, adp, mg, sf4

Details for d1ao0b1

PDB Entry: 1ao0, 2.8 Å

PDB Description: glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp

PDB Compounds: (B:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ao0b1:

Sequence; same for both SEQRES and ATOM records:

>d1ao0b1 c.61.1.1 (B:235-459) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
icsmeyiyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaea
tgipyelgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgtts
rrivtmlreagatevhvkissppiahpcfygidtstheeliasshsveeirqeigadtls
flsvegllkgigrkyddsncgqclacftgkypteiyqdtvlphvk

Timeline for d1ao0b1:

• d1ao0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ao0b1 appears in SCOPe 2.07