Lineage for d5xfhb_ (5xfh B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422754Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2422755Protein automated matches [190516] (5 species)
    not a true protein
  7. 2422795Species Oryza sativa [TaxId:39947] [340345] (1 PDB entry)
  8. 2422797Domain d5xfhb_: 5xfh B: [340355]
    automated match to d1x1vb_
    complexed with bma, gal, man, nag

Details for d5xfhb_

PDB Entry: 5xfh (more details), 1.9 Å

PDB Description: crystal structure of orysata lectin in complex with biantennary n- glycan
PDB Compounds: (B:) Salt stress-induced protein

SCOPe Domain Sequences for d5xfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfhb_ b.77.3.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
tlvkigpwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggge
ststeiklgsseqikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplqd
sghvvgffgrsgtlidaigiyvhp

SCOPe Domain Coordinates for d5xfhb_:

Click to download the PDB-style file with coordinates for d5xfhb_.
(The format of our PDB-style files is described here.)

Timeline for d5xfhb_: