Class b: All beta proteins [48724] (177 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
Protein automated matches [190516] (4 species) not a true protein |
Species Oryza sativa [TaxId:39947] [340345] (1 PDB entry) |
Domain d5xfhb_: 5xfh B: [340355] automated match to d1x1vb_ complexed with bma, gal, man, nag |
PDB Entry: 5xfh (more details), 1.9 Å
SCOPe Domain Sequences for d5xfhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xfhb_ b.77.3.0 (B:) automated matches {Oryza sativa [TaxId: 39947]} tlvkigpwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggge ststeiklgsseqikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplqd sghvvgffgrsgtlidaigiyvhp
Timeline for d5xfhb_: