SCOPe 2.06: Domain d5xfhb_: 5xfh B:

Lineage for d5xfhb_ (5xfh B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (4 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [340345] (1 PDB entry)

8. Domain d5xfhb_: 5xfh B: [340355]
   automated match to d1x1vb_
   complexed with bma, gal, man, nag

Details for d5xfhb_

PDB Entry: 5xfh, 1.9 Å

PDB Description: crystal structure of orysata lectin in complex with biantennary n- glycan

PDB Compounds: (B:) Salt stress-induced protein

SCOPe Domain Sequences for d5xfhb_:

Sequence; same for both SEQRES and ATOM records:

>d5xfhb_ b.77.3.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
tlvkigpwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggge
ststeiklgsseqikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplqd
sghvvgffgrsgtlidaigiyvhp

Timeline for d5xfhb_:

• d5xfhb_ is new in SCOPe 2.06-stable
  
• d5xfhb_ appears in SCOPe 2.07
  
• d5xfhb_ appears in the current release, SCOPe 2.08