Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries) |
Domain d5tmaa1: 5tma A:1-187 [340326] Other proteins in same PDB: d5tmaa2, d5tmab2 automated match to d1zpda2 complexed with edo, mg, so4, tpp; mutant |
PDB Entry: 5tma (more details), 1.67 Å
SCOPe Domain Sequences for d5tmaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmaa1 c.36.1.0 (A:1-187) automated matches {Zymomonas mobilis [TaxId: 542]} mdytvgtylaerlvqiglkhhfavagdynlvlldnlldnknmeqvyccnelncgfsaegy arakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaahvlhhalgktd yhyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgp asalfnd
Timeline for d5tmaa1: