SCOPe 2.08: Domain d5njcb_: 5njc B:

Lineage for d5njcb_ (5njc B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.283: Putative modulator of DNA gyrase, PmbA/TldD [111282] (1 superfamily)
   consists of two different alpha+beta domains; d1: [duplication of alpha-beta(3)-alpha motif; 2 layers: a/b; antiparallel beta-sheet, order: 321456; strands 1, 2, 4 and 5 are twice longer than other secondary structures]; d2 [ complex fold; contains beta-barrel (n=5, S=10)]

4. Superfamily d.283.1: Putative modulator of DNA gyrase, PmbA/TldD [111283] (2 families)

5. Family d.283.1.0: automated matches [339783] (1 protein)
   not a true family

6. Protein automated matches [339784] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [339785] (2 PDB entries)

8. Domain d5njcb_: 5njc B: [339807]
   automated match to d1vpba_
   complexed with edo, mes, na, zn; mutant

Details for d5njcb_

PDB Entry: 5njc, 1.35 Å

PDB Description: e. coli microcin-processing metalloprotease tldd/e (tldd e263a mutant) with hexapeptide bound

PDB Compounds: (B:) Metalloprotease PmbA

SCOPe Domain Sequences for d5njcb_:

Sequence; same for both SEQRES and ATOM records:

>d5njcb_ d.283.1.0 (B:) automated matches {Escherichia coli [TaxId: 511145]}
isqveaqrkileeavstalelasgksdgaevavskttgisvstrygevenvefnsdgalg
itvyhqnrkgsasstdlspqaiartvqaaldiarytspdpcagvadkellafdapdldlf
hpaevspdeaielaaraeqaalqadkritnteggsfnshygvkvfgnshgmlqgycstrh
slsscviaeengdmerdyaytigramsdlqtpewvgadcarrtlsrlsprklstmkapvi
fanevatglfghlvgaiaggsvyrkstflldslgkqilpdwltieehphllkglastpfd
segvrterrdiikdgiltqwlltsysarklglkstghaggihnwriagqglsfeqmlkem
gtglvvtelmgqgvsaitgdysrgaagfwvengeiqypvseitiagnlkdmwrnivtvgn
dietrsniqcgsvllpemkiagq

Timeline for d5njcb_:

• d5njcb_ first appeared in SCOPe 2.06
  
• d5njcb_ appears in SCOPe 2.07