Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.283: Putative modulator of DNA gyrase, PmbA/TldD [111282] (1 superfamily) consists of two different alpha+beta domains; d1: [duplication of alpha-beta(3)-alpha motif; 2 layers: a/b; antiparallel beta-sheet, order: 321456; strands 1, 2, 4 and 5 are twice longer than other secondary structures]; d2 [ complex fold; contains beta-barrel (n=5, S=10)] |
Superfamily d.283.1: Putative modulator of DNA gyrase, PmbA/TldD [111283] (2 families) |
Family d.283.1.0: automated matches [339783] (1 protein) not a true family |
Protein automated matches [339784] (3 species) not a true protein |
Species Escherichia coli [TaxId:511145] [339785] (2 PDB entries) |
Domain d5njcb_: 5njc B: [339807] automated match to d1vpba_ complexed with edo, mes, na, zn; mutant |
PDB Entry: 5njc (more details), 1.35 Å
SCOPe Domain Sequences for d5njcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5njcb_ d.283.1.0 (B:) automated matches {Escherichia coli [TaxId: 511145]} isqveaqrkileeavstalelasgksdgaevavskttgisvstrygevenvefnsdgalg itvyhqnrkgsasstdlspqaiartvqaaldiarytspdpcagvadkellafdapdldlf hpaevspdeaielaaraeqaalqadkritnteggsfnshygvkvfgnshgmlqgycstrh slsscviaeengdmerdyaytigramsdlqtpewvgadcarrtlsrlsprklstmkapvi fanevatglfghlvgaiaggsvyrkstflldslgkqilpdwltieehphllkglastpfd segvrterrdiikdgiltqwlltsysarklglkstghaggihnwriagqglsfeqmlkem gtglvvtelmgqgvsaitgdysrgaagfwvengeiqypvseitiagnlkdmwrnivtvgn dietrsniqcgsvllpemkiagq
Timeline for d5njcb_: