Lineage for d5h0ua_ (5h0u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964641Protein automated matches [190182] (1 species)
    not a true protein
  7. 2964642Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2964685Domain d5h0ua_: 5h0u A: [339760]
    automated match to d1buvm_
    complexed with ca, epe, gol, zn

Details for d5h0ua_

PDB Entry: 5h0u (more details), 2.24 Å

PDB Description: crystal structure of the catalytic domain of membrane type 1 matrix metalloproteinase
PDB Compounds: (A:) Matrix metalloproteinase-14

SCOPe Domain Sequences for d5h0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h0ua_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghekqa
dimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndifl
vavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygg

SCOPe Domain Coordinates for d5h0ua_:

Click to download the PDB-style file with coordinates for d5h0ua_.
(The format of our PDB-style files is described here.)

Timeline for d5h0ua_: