SCOPe 2.08: Domain d5oxgc1: 5oxg C:201-499

Lineage for d5oxgc1 (5oxg C:201-499)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5oxgc1: 5oxg C:201-499 [339277]
   Other proteins in same PDB: d5oxgc2
   automated match to d3q4ud_
   complexed with b4b, ca, edo

Details for d5oxgc1

PDB Entry: 5oxg, 2.13 Å

PDB Description: crystal structure of the acvr1 (alk2) kinase in complex with ldn- 212854

PDB Compounds: (C:) Activin receptor type-1

SCOPe Domain Sequences for d5oxgc1:

Sequence; same for both SEQRES and ATOM records:

>d5oxgc1 d.144.1.7 (C:201-499) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhe
nilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlh
ieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkr
ymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndps
fedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid

Timeline for d5oxgc1:

• d5oxgc1 first appeared in SCOPe 2.06
  
• d5oxgc1 appears in SCOPe 2.07