Lineage for d1b3bc2 (1b3b C:4-178)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) 
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) 
Protein Glutamate dehydrogenase [53225] (6 species) 
Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries) 
Domain d1b3bc2: 1b3b C:4-178 [33894]
Other proteins in same PDB: d1b3ba1, d1b3bb1, d1b3bc1, d1b3bd1, d1b3be1, d1b3bf1
Details for d1b3bc2
PDB Entry: 1b3b (more details), 3.1 Å
PDB Description: thermotoga maritima glutamate dehydrogenase mutant n97d, g376k
SCOP Domain Sequences for d1b3bc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3bc2 c.58.1.1 (C:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel
SCOP Domain Coordinates for d1b3bc2:
Click to download the PDB-style file with coordinates for d1b3bc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b3bc2:
View in 3D
