Lineage for d1b3bf1 (1b3b F:179-412)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66936Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 66937Protein Glutamate dehydrogenase [51884] (6 species)
  7. 66982Species Thermotoga maritima [TaxId:243274] [51888] (3 PDB entries)
  8. 67000Domain d1b3bf1: 1b3b F:179-412 [30249]
    Other proteins in same PDB: d1b3ba2, d1b3bb2, d1b3bc2, d1b3bd2, d1b3be2, d1b3bf2

Details for d1b3bf1

PDB Entry: 1b3b (more details), 3.1 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant n97d, g376k

SCOP Domain Sequences for d1b3bf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3bf1 c.2.1.7 (F:179-412) Glutamate dehydrogenase {Thermotoga maritima}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg

SCOP Domain Coordinates for d1b3bf1:

Click to download the PDB-style file with coordinates for d1b3bf1.
(The format of our PDB-style files is described here.)

Timeline for d1b3bf1: