Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein Glutamate dehydrogenase [53225] (8 species) |
Species Thermotoga maritima [TaxId:2336] [53229] (3 PDB entries) |
Domain d1b3bc2: 1b3b C:4-178 [33894] Other proteins in same PDB: d1b3ba1, d1b3bb1, d1b3bc1, d1b3bd1, d1b3be1, d1b3bf1 mutant |
PDB Entry: 1b3b (more details), 3.1 Å
SCOPe Domain Sequences for d1b3bc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3bc2 c.58.1.1 (C:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel
Timeline for d1b3bc2: