SCOPe 2.08: Domain d1b3bc2: 1b3b C:4-178

Lineage for d1b3bc2 (1b3b C:4-178)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein Glutamate dehydrogenase [53225] (8 species)

7. Species Thermotoga maritima [TaxId:2336] [53229] (3 PDB entries)

8. Domain d1b3bc2: 1b3b C:4-178 [33894]
   Other proteins in same PDB: d1b3ba1, d1b3bb1, d1b3bc1, d1b3bd1, d1b3be1, d1b3bf1
   mutant

Details for d1b3bc2

PDB Entry: 1b3b, 3.1 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant n97d, g376k

PDB Compounds: (C:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d1b3bc2:

Sequence; same for both SEQRES and ATOM records:

>d1b3bc2 c.58.1.1 (C:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel

Timeline for d1b3bc2:

• d1b3bc2 first appeared (with stable ids) in SCOP 1.55
  
• d1b3bc2 appears in SCOPe 2.07