Lineage for d1b26f2 (1b26 F:4-178)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1862683Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1862684Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1862685Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 1862686Protein Glutamate dehydrogenase [53225] (8 species)
  7. 1862781Species Thermotoga maritima [TaxId:2336] [53229] (3 PDB entries)
  8. 1862787Domain d1b26f2: 1b26 F:4-178 [33885]
    Other proteins in same PDB: d1b26a1, d1b26b1, d1b26c1, d1b26d1, d1b26e1, d1b26f1

Details for d1b26f2

PDB Entry: 1b26 (more details), 3 Å

PDB Description: glutamate dehydrogenase
PDB Compounds: (F:) glutamate dehydrogenase

SCOPe Domain Sequences for d1b26f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b26f2 c.58.1.1 (F:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel

SCOPe Domain Coordinates for d1b26f2:

Click to download the PDB-style file with coordinates for d1b26f2.
(The format of our PDB-style files is described here.)

Timeline for d1b26f2: