Lineage for d1b26a1 (1b26 A:179-412)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830007Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1830008Protein Glutamate dehydrogenase [51884] (8 species)
  7. 1830103Species Thermotoga maritima [TaxId:2336] [51888] (3 PDB entries)
  8. 1830104Domain d1b26a1: 1b26 A:179-412 [30232]
    Other proteins in same PDB: d1b26a2, d1b26b2, d1b26c2, d1b26d2, d1b26e2, d1b26f2

Details for d1b26a1

PDB Entry: 1b26 (more details), 3 Å

PDB Description: glutamate dehydrogenase
PDB Compounds: (A:) glutamate dehydrogenase

SCOPe Domain Sequences for d1b26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
ggskgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvva
vsdsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegai
hagnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqs
ffwdldqvrnalekmmkgafndvmkvkekynvdmrtaayilaidrvayatkkrg

SCOPe Domain Coordinates for d1b26a1:

Click to download the PDB-style file with coordinates for d1b26a1.
(The format of our PDB-style files is described here.)

Timeline for d1b26a1: