Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Tuber melanosporum [TaxId:656061] [338192] (2 PDB entries) |
Domain d5mifd_: 5mif D: [338195] automated match to d4v2ia_ complexed with trt |
PDB Entry: 5mif (more details), 2.14 Å
SCOPe Domain Sequences for d5mifd_:
Sequence, based on SEQRES records: (download)
>d5mifd_ c.69.1.0 (D:) automated matches {Tuber melanosporum [TaxId: 656061]} qldpitqayadaissrpslfafplpeirdgyqsnvsdpstefttkilslpvgptgnvtay lykpvsgerekgkdllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpk vaypvpneqcyaavqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkf qvliypatdlacesatfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedl akfpetlivvaevdpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgaka tieligykfkkalh
>d5mifd_ c.69.1.0 (D:) automated matches {Tuber melanosporum [TaxId: 656061]} qldpitqayadaissrpslfafplpeirdgyqstefttkilslpvgptgnvtaylykpvs dllpviayfhgggwvfggpksyrglitnliresgaavffvdytltpkvaypvpneqcyaa vqwllehgeklgvdptnmgfggdsaggelsssvsllsikrktplpkfqvliypatdlace satfkefpngpglttdeirfaaslftpdpksrledvaspgrasdedlakfpetlivvaev dpirqqgedfgrrlqklgvraaiirvlgtihgfasidvlseapgakatieligykfkkal h
Timeline for d5mifd_: