Lineage for d5x19e_ (5x19 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727276Domain d5x19e_: 5x19 E: [337749]
    Other proteins in same PDB: d5x19a_, d5x19b1, d5x19b2, d5x19c_, d5x19d_, d5x19f_, d5x19g_, d5x19h_, d5x19i_, d5x19j_, d5x19k_, d5x19l_, d5x19m_, d5x19n_, d5x19o1, d5x19o2, d5x19p_, d5x19q_, d5x19s_, d5x19t_, d5x19u_, d5x19v_, d5x19w_, d5x19x_, d5x19y_, d5x19z_
    automated match to d1v54e_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x19e_

PDB Entry: 5x19 (more details), 2.2 Å

PDB Description: co bound cytochrome c oxidase at 100 micro sec after pump laser irradiation to release co from o2 reduction center
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5x19e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x19e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5x19e_:

Click to download the PDB-style file with coordinates for d5x19e_.
(The format of our PDB-style files is described here.)

Timeline for d5x19e_: