Lineage for d5vxba_ (5vxb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212030Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 2212031Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 2212032Family d.116.1.1: YbaK/ProRS associated domain [55827] (4 proteins)
    Pfam PF04073
  6. 2212041Protein Hypothetical protein CC0111 [103220] (1 species)
    annotated as putative DNA-binding protein
  7. 2212042Species Caulobacter crescentus [TaxId:155892] [103221] (2 PDB entries)
  8. 2212044Domain d5vxba_: 5vxb A: [337672]
    automated match to d1vjfa_

Details for d5vxba_

PDB Entry: 5vxb (more details), 1.69 Å

PDB Description: crystal structure of caulobacter crescentus proxp-ala at 1.69 angstrom
PDB Compounds: (A:) ProXp-ala

SCOPe Domain Sequences for d5vxba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vxba_ d.116.1.1 (A:) Hypothetical protein CC0111 {Caulobacter crescentus [TaxId: 155892]}
mktradlfaffdahgvdhktldhppvfrveegleikaampgghtknlflkdakgqlwlis
algettidlkklhhvigsgrlsfgpqemmletlgvtpgsvtafglindtekrvrfvldka
ladsdpvnfhplkndattavsqaglrrflaalgvepmivdfaamevvg

SCOPe Domain Coordinates for d5vxba_:

Click to download the PDB-style file with coordinates for d5vxba_.
(The format of our PDB-style files is described here.)

Timeline for d5vxba_: