Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily) core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet |
Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) |
Family d.116.1.1: YbaK/ProRS associated domain [55827] (4 proteins) Pfam PF04073 |
Protein Hypothetical protein CC0111 [103220] (1 species) annotated as putative DNA-binding protein |
Species Caulobacter crescentus [TaxId:155892] [103221] (2 PDB entries) |
Domain d5vxba_: 5vxb A: [337672] automated match to d1vjfa_ |
PDB Entry: 5vxb (more details), 1.69 Å
SCOPe Domain Sequences for d5vxba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vxba_ d.116.1.1 (A:) Hypothetical protein CC0111 {Caulobacter crescentus [TaxId: 155892]} mktradlfaffdahgvdhktldhppvfrveegleikaampgghtknlflkdakgqlwlis algettidlkklhhvigsgrlsfgpqemmletlgvtpgsvtafglindtekrvrfvldka ladsdpvnfhplkndattavsqaglrrflaalgvepmivdfaamevvg
Timeline for d5vxba_: