Lineage for d5xl2b2 (5xl2 B:333-499)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646510Species Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId:137611] [337394] (1 PDB entry)
  8. 2646512Domain d5xl2b2: 5xl2 B:333-499 [337449]
    Other proteins in same PDB: d5xl2a1, d5xl2b1, d5xl2c1
    automated match to d1ha0a2
    complexed with nag

Details for d5xl2b2

PDB Entry: 5xl2 (more details), 2.3 Å

PDB Description: the structure of hemagglutininfrom a swine-origin h4n6 influenza virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5xl2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl2b2 h.3.1.0 (B:333-499) automated matches {Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId: 137611]}
iagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliekpnekyhq
iekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrhq
lrenaedkgngcfeifhqcdnsciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xl2b2:

Click to download the PDB-style file with coordinates for d5xl2b2.
(The format of our PDB-style files is described here.)

Timeline for d5xl2b2: