Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId:137611] [337394] (1 PDB entry) |
Domain d5xl2b2: 5xl2 B:333-499 [337449] Other proteins in same PDB: d5xl2a1, d5xl2b1, d5xl2c1 automated match to d1ha0a2 complexed with nag |
PDB Entry: 5xl2 (more details), 2.3 Å
SCOPe Domain Sequences for d5xl2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xl2b2 h.3.1.0 (B:333-499) automated matches {Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId: 137611]} iagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliekpnekyhq iekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrhq lrenaedkgngcfeifhqcdnsciesirngtydhdiyrdeainnrfq
Timeline for d5xl2b2:
View in 3D Domains from other chains: (mouse over for more information) d5xl2a1, d5xl2a2, d5xl2c1, d5xl2c2 |