SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xl2b2 (5xl2 B:333-499)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (21 species)
    not a true protein
  7. 2294093Species Influenza a virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId:137611] [337394] (1 PDB entry)
  8. 2294148Domain d5xl2b2: 5xl2 B:333-499 [337449]
    Other proteins in same PDB: d5xl2a1, d5xl2b1, d5xl2c1
    automated match to d1ha0a2
    complexed with nag

Details for d5xl2b2

PDB Entry: 5xl2 (more details), 2.3 Å

PDB Description: the structure of hemagglutininfrom a swine-origin h4n6 influenza virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5xl2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl2b2 h.3.1.0 (B:333-499) automated matches {Influenza a virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId: 137611]}
iagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliekpnekyhq
iekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrhq
lrenaedkgngcfeifhqcdnsciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xl2b2:

Click to download the PDB-style file with coordinates for d5xl2b2.
(The format of our PDB-style files is described here.)

Timeline for d5xl2b2:

  • d5xl2b2 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03