SCOPe 2.07: Domain d5xl2c2: 5xl2 C:335-499

Lineage for d5xl2c2 (5xl2 C:335-499)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId:137611] [337394] (1 PDB entry)

8. Domain d5xl2c2: 5xl2 C:335-499 [337395]
   Other proteins in same PDB: d5xl2a1, d5xl2b1, d5xl2c1
   automated match to d1ha0a2
   complexed with nag

Details for d5xl2c2

PDB Entry: 5xl2, 2.3 Å

PDB Description: the structure of hemagglutininfrom a swine-origin h4n6 influenza virus

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5xl2c2:

Sequence; same for both SEQRES and ATOM records:

>d5xl2c2 h.3.1.0 (C:335-499) automated matches {Influenza A virus (a/swine/ontario/01911-1/99 (h4n6)) [TaxId: 137611]}
gfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliekpnekyhqie
kefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfervrhqlr
enaedkgngcfeifhqcdnsciesirngtydhdiyrdeainnrfq

Timeline for d5xl2c2:

• d5xl2c2 first appeared in SCOPe 2.06
  
• d5xl2c2 appears in the current release, SCOPe 2.08