Lineage for d5xqya_ (5xqy A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034180Domain d5xqya_: 5xqy A: [337425]
    automated match to d4v1db_
    mutant

Details for d5xqya_

PDB Entry: 5xqy (more details), 2.9 Å

PDB Description: structure of monomeric mutant of rei immunoglobulin light chain variable domain crystallized at ph 8
PDB Compounds: (A:) Immunoglobulin kappa variable 1D-33

SCOPe Domain Sequences for d5xqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xqya_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr

SCOPe Domain Coordinates for d5xqya_:

Click to download the PDB-style file with coordinates for d5xqya_.
(The format of our PDB-style files is described here.)

Timeline for d5xqya_: