PDB entry 5xqy

View 5xqy on RCSB PDB site
Description: Structure of monomeric mutant of REI immunoglobulin light chain variable domain crystallized at pH 8
Class: immune system
Keywords: Immunoglobulin, IMMUNE SYSTEM
Deposited on 2017-06-07, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqya_
• Chain 'B':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqyb_
• Chain 'C':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqyc_
• Chain 'D':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqyd_
• Chain 'E':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqye_
• Chain 'F':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqyf_
• Chain 'G':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqyg_
• Chain 'H':
  Compound: Immunoglobulin kappa variable 1D-33
  Species: Homo sapiens [TaxId:9606]
  Gene: IGKV1D-33
  Database cross-references and differences (RAF-indexed):
  • PDB 5XQY (0-108)
  Domains in SCOPe 2.06: d5xqyh_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyA (A:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyB (B:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyC (C:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyD (D:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyE (E:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyF (F:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyG (G:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5xqyH (H:)
  adiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvp
  srfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr