Lineage for d5h7ae2 (5h7a E:87-131)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310326Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2310327Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2310328Protein Immunoglobulin-binding protein A modules [46999] (1 species)
  7. 2310329Species Staphylococcus aureus [TaxId:1280] [47000] (24 PDB entries)
  8. 2310371Domain d5h7ae2: 5h7a E:87-131 [336315]
    Other proteins in same PDB: d5h7ab5, d5h7ac5
    automated match to d2otke_

Details for d5h7ae2

PDB Entry: 5h7a (more details), 2.7 Å

PDB Description: crystal structure of a repeat protein with four protein a repeat module
PDB Compounds: (E:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d5h7ae2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7ae2 a.8.1.1 (E:87-131) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
afyeilslpnlneeqrnafiqslkddpsqsanllaeakklneqqa

SCOPe Domain Coordinates for d5h7ae2:

Click to download the PDB-style file with coordinates for d5h7ae2.
(The format of our PDB-style files is described here.)

Timeline for d5h7ae2:

View in 3D
Domains from other chains:
(mouse over for more information)
d5h7aa1, d5h7aa2, d5h7aa3, d5h7aa4, d5h7ab1, d5h7ab2, d5h7ab3, d5h7ab4, d5h7ab5, d5h7ac1, d5h7ac2, d5h7ac3, d5h7ac4, d5h7ac5, d5h7ad1, d5h7ad2, d5h7ad3, d5h7ad4, d5h7af1, d5h7af2, d5h7af3, d5h7af4, d5h7ag1, d5h7ag2, d5h7ag3, d5h7ag4, d5h7ah1, d5h7ah2, d5h7ah3, d5h7ah4, d5h7ai1, d5h7ai2, d5h7ai3, d5h7ai4, d5h7aj1, d5h7aj2, d5h7aj3, d5h7aj4, d5h7ak1, d5h7ak2, d5h7ak3, d5h7ak4, d5h7al1, d5h7al2, d5h7al3, d5h7al4