Lineage for d2otke_ (2otk E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310326Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2310327Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2310424Protein automated matches [191290] (5 species)
    not a true protein
  7. 2310427Species Engineered binding [255533] (1 PDB entry)
  8. 2310428Domain d2otke_: 2otk E: [243378]
    automated match to d1ss1a_

Details for d2otke_

PDB Entry: 2otk (more details)

PDB Description: structure of alzheimer ab peptide in complex with an engineered binding protein
PDB Compounds: (E:) ZAb3 Affibody dimer

SCOPe Domain Sequences for d2otke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otke_ a.8.1.1 (E:) automated matches {Engineered binding}
geivylpnlnpdqlcafihslhddpsqsanllaeakklndaqa

SCOPe Domain Coordinates for d2otke_:

Click to download the PDB-style file with coordinates for d2otke_.
(The format of our PDB-style files is described here.)

Timeline for d2otke_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2otkf_