Class a: All alpha proteins [46456] (289 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein automated matches [191290] (5 species) not a true protein |
Species Engineered binding [255533] (1 PDB entry) |
Domain d2otke_: 2otk E: [243378] automated match to d1ss1a_ |
PDB Entry: 2otk (more details)
SCOPe Domain Sequences for d2otke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otke_ a.8.1.1 (E:) automated matches {Engineered binding} geivylpnlnpdqlcafihslhddpsqsanllaeakklndaqa
Timeline for d2otke_: