Class a: All alpha proteins [46456] (289 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein Immunoglobulin-binding protein A modules [46999] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [47000] (24 PDB entries) |
Domain d5h7aa4: 5h7a A:177-221 [336036] Other proteins in same PDB: d5h7ab5, d5h7ac5 automated match to d2otke_ |
PDB Entry: 5h7a (more details), 2.7 Å
SCOPe Domain Sequences for d5h7aa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7aa4 a.8.1.1 (A:177-221) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]} afyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqa
Timeline for d5h7aa4:
View in 3D Domains from other chains: (mouse over for more information) d5h7ab1, d5h7ab2, d5h7ab3, d5h7ab4, d5h7ab5, d5h7ac1, d5h7ac2, d5h7ac3, d5h7ac4, d5h7ac5, d5h7ad1, d5h7ad2, d5h7ad3, d5h7ad4, d5h7ae1, d5h7ae2, d5h7ae3, d5h7ae4, d5h7af1, d5h7af2, d5h7af3, d5h7af4, d5h7ag1, d5h7ag2, d5h7ag3, d5h7ag4, d5h7ah1, d5h7ah2, d5h7ah3, d5h7ah4, d5h7ai1, d5h7ai2, d5h7ai3, d5h7ai4, d5h7aj1, d5h7aj2, d5h7aj3, d5h7aj4, d5h7ak1, d5h7ak2, d5h7ak3, d5h7ak4, d5h7al1, d5h7al2, d5h7al3, d5h7al4 |