SCOPe 2.07: Domain d5paca_: 5pac A:

Lineage for d5paca_ (5pac A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d5paca_: 5pac A: [335708]
   Other proteins in same PDB: d5pacb_
   automated match to d1klil_
   complexed with 7y7, ca, cl, gol, so4

Details for d5paca_

PDB Entry: 5pac, 1.5 Å

PDB Description: human factor viia in complex with 5-hydroxy-n-(4-oxo-3h-quinazolin-6- yl)-1-[3-[(phenylcarbamoylamino)methyl]phenyl]pyrazole-4-carboxamide at 1.50a

PDB Compounds: (A:) Coagulation factor VII light chain

SCOPe Domain Sequences for d5paca_:

Sequence; same for both SEQRES and ATOM records:

>d5paca_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekrna

Timeline for d5paca_:

• d5paca_ first appeared in SCOPe 2.06
  
• d5paca_ appears in the current release, SCOPe 2.08