Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
Domain d5paca_: 5pac A: [335708] Other proteins in same PDB: d5pacb_ automated match to d1klil_ complexed with 7y7, ca, cl, gol, so4 |
PDB Entry: 5pac (more details), 1.5 Å
SCOPe Domain Sequences for d5paca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5paca_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekrna
Timeline for d5paca_: