Lineage for d5naja_ (5naj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803479Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2803517Protein automated matches [226957] (2 species)
    not a true protein
  7. 2803518Species Human (Homo sapiens) [TaxId:9606] [225382] (12 PDB entries)
  8. 2803531Domain d5naja_: 5naj A: [334598]
    automated match to d2iyba_
    complexed with 8sb, 8se, cl, so4

Details for d5naja_

PDB Entry: 5naj (more details), 1.46 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-1]-[prom-1]-oh
PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d5naja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5naja_ b.55.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d5naja_:

Click to download the PDB-style file with coordinates for d5naja_.
(The format of our PDB-style files is described here.)

Timeline for d5naja_: