SCOPe 2.06: Domain d5n1za_: 5n1z A:

Lineage for d5n1za_ (5n1z A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (21 PDB entries)

8. Domain d5n1za_: 5n1z A: [334220]
   automated match to d1r2ba_
   complexed with 8gq, cl

Details for d5n1za_

PDB Entry: 5n1z, 1.81 Å

PDB Description: crystal structure of the bcl6 btb domain in complex with pyrazolo- pyrimidine macrocyclic ligand

PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d5n1za_:

Sequence; same for both SEQRES and ATOM records:

>d5n1za_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
dsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfi
kas

Timeline for d5n1za_:

• d5n1za_ is new in SCOPe 2.06-stable
  
• d5n1za_ appears in SCOPe 2.07
  
• d5n1za_ appears in the current release, SCOPe 2.08