PDB entry 5n1z

View 5n1z on RCSB PDB site
Description: Crystal structure of the BCL6 BTB domain in complex with pyrazolo-pyrimidine macrocyclic ligand
Class: transferase
Keywords: KINASE, transferase
Deposited on 2017-02-06, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 6 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL6, BCL5, LAZ3, ZBTB27, ZNF51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41182 (0-122)
      • engineered mutation (2)
      • engineered mutation (61)
      • engineered mutation (78)
    Domains in SCOPe 2.06: d5n1za_
  • Heterogens: CL, 8GQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5n1zA (A:)
    dsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdql
    krnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfi
    kas