Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.0: automated matches [227244] (1 protein) not a true family |
Protein automated matches [227010] (5 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [236135] (6 PDB entries) |
Domain d5noob_: 5noo B: [333914] automated match to d4irra_ complexed with d16, ump |
PDB Entry: 5noo (more details), 2.9 Å
SCOPe Domain Sequences for d5noob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5noob_ d.117.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} qvhlnqdeykylkqveqilregtrrddrtgtgtisifgmqskyclrngtipllttkrvyw kgvleellwfisgstdgkllmeknvkiwekngdrafldnlgftsreegdlgpvygfqwrh fgakyvdchtdysgqgvdqlaevirqikeqpdsrriimsawnpsdlgqmvlppchtmcqf yvdngelscqlyqrsgdmglgvpfnlasygllthmiakvcglkpgtlvhtlgdahvysnh vdalkiqldrepyafpkirftrdvasiddftsdmialddykchpkip
Timeline for d5noob_: