Lineage for d5noob_ (5noo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972770Family d.117.1.0: automated matches [227244] (1 protein)
    not a true family
  6. 2972771Protein automated matches [227010] (5 species)
    not a true protein
  7. 2972789Species Nematode (Caenorhabditis elegans) [TaxId:6239] [236135] (6 PDB entries)
  8. 2972799Domain d5noob_: 5noo B: [333914]
    automated match to d4irra_
    complexed with d16, ump

Details for d5noob_

PDB Entry: 5noo (more details), 2.9 Å

PDB Description: crystal structure of c.elegans thymidylate synthase in complex with dump and tomudex
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d5noob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5noob_ d.117.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qvhlnqdeykylkqveqilregtrrddrtgtgtisifgmqskyclrngtipllttkrvyw
kgvleellwfisgstdgkllmeknvkiwekngdrafldnlgftsreegdlgpvygfqwrh
fgakyvdchtdysgqgvdqlaevirqikeqpdsrriimsawnpsdlgqmvlppchtmcqf
yvdngelscqlyqrsgdmglgvpfnlasygllthmiakvcglkpgtlvhtlgdahvysnh
vdalkiqldrepyafpkirftrdvasiddftsdmialddykchpkip

SCOPe Domain Coordinates for d5noob_:

Click to download the PDB-style file with coordinates for d5noob_.
(The format of our PDB-style files is described here.)

Timeline for d5noob_: