SCOPe 2.08: Domain d5huua_: 5huu A:

Lineage for d5huua_ (5huu A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.0: automated matches [191559] (1 protein)
   not a true family

6. Protein automated matches [190965] (40 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [333712] (4 PDB entries)

8. Domain d5huua_: 5huu A: [333814]
   automated match to d2wtxb_
   complexed with g6p, udp

Details for d5huua_

PDB Entry: 5huu, 2.37 Å

PDB Description: structure of candida albicans trehalose-6-phosphate synthase in complex with udp and glucose-6-phosphate

PDB Compounds: (A:) Alpha,alpha-trehalose-phosphate synthase [UDP-forming]

SCOPe Domain Sequences for d5huua_:

Sequence; same for both SEQRES and ATOM records:

>d5huua_ c.87.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt
kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank
kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril
pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig
idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe
wigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfdeli
slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte
dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnp

Timeline for d5huua_:

• d5huua_ first appeared in SCOPe 2.06
  
• d5huua_ appears in SCOPe 2.07