Lineage for d5jvna2 (5jvn A:380-513)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459236Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2459237Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2459269Family c.8.1.0: automated matches [310665] (1 protein)
    not a true family
  6. 2459270Protein automated matches [310840] (3 species)
    not a true protein
  7. 2459271Species Flaveria pringlei [TaxId:4226] [332630] (1 PDB entry)
  8. 2459272Domain d5jvna2: 5jvn A:380-513 [332631]
    Other proteins in same PDB: d5jvna1, d5jvna3, d5jvna4
    automated match to d2x0sa2
    complexed with 6nq, mg, pep

Details for d5jvna2

PDB Entry: 5jvn (more details), 2.9 Å

PDB Description: c3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism
PDB Compounds: (A:) Pyruvate, phosphate dikinase, chloroplastic

SCOPe Domain Sequences for d5jvna2:

Sequence, based on SEQRES records: (download)

>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]}
pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg
mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltigdrvikegdwlsl
ngstgevilgkqll

Sequence, based on observed residues (ATOM records): (download)

>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]}
pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg
mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltirvikegdwlslng
stgevilgkqll

SCOPe Domain Coordinates for d5jvna2:

Click to download the PDB-style file with coordinates for d5jvna2.
(The format of our PDB-style files is described here.)

Timeline for d5jvna2: