Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) contains barrel, closed, n=7, S=10 |
Family c.8.1.0: automated matches [310665] (1 protein) not a true family |
Protein automated matches [310840] (3 species) not a true protein |
Species Flaveria pringlei [TaxId:4226] [332630] (1 PDB entry) |
Domain d5jvna2: 5jvn A:380-513 [332631] Other proteins in same PDB: d5jvna1, d5jvna3, d5jvna4 automated match to d2x0sa2 complexed with 6nq, mg, pep |
PDB Entry: 5jvn (more details), 2.9 Å
SCOPe Domain Sequences for d5jvna2:
Sequence, based on SEQRES records: (download)
>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]} pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltigdrvikegdwlsl ngstgevilgkqll
>d5jvna2 c.8.1.0 (A:380-513) automated matches {Flaveria pringlei [TaxId: 4226]} pqfenpsaykshvvatglpaspgaavgqvvfsaedaetwhaqgksailvrtetspedvgg mhaaagiltarggmtshaavvargwgkccvsgcadirvnddmkvltirvikegdwlslng stgevilgkqll
Timeline for d5jvna2: