Lineage for d5isoe2 (5iso E:183-324)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550321Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2550322Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2550323Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2550341Domain d5isoe2: 5iso E:183-324 [332468]
    automated match to d2v8qe1
    complexed with 992, amp, stu

Details for d5isoe2

PDB Entry: 5iso (more details), 2.63 Å

PDB Description: structure of full length human ampk (non-phosphorylated at t-loop) in complex with a small molecule activator, a benzimidazole derivative (991)
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d5isoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5isoe2 d.37.1.1 (E:183-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvl

SCOPe Domain Coordinates for d5isoe2:

Click to download the PDB-style file with coordinates for d5isoe2.
(The format of our PDB-style files is described here.)

Timeline for d5isoe2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5isoe1