SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5isoe2 (5iso E:183-324)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167407Family d.37.1.1: CBS-domain pair [54632] (21 protein domains)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2167408Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2167409Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (10 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2289167Domain d5isoe2: 5iso E:183-324 [332468]
    automated match to d2v8qe1
    complexed with 992, amp, stu

Details for d5isoe2

PDB Entry: 5iso (more details), 2.63 Å

PDB Description: structure of full length human ampk (non-phosphorylated at t-loop) in complex with a small molecule activator, a benzimidazole derivative (991)
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d5isoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5isoe2 d.37.1.1 (E:183-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvl

SCOPe Domain Coordinates for d5isoe2:

Click to download the PDB-style file with coordinates for d5isoe2.
(The format of our PDB-style files is described here.)

Timeline for d5isoe2:

  • d5isoe2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5isoe1