Lineage for d5kwja_ (5kwj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151111Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins)
    automatically mapped to Pfam PF00756
  6. 2151132Protein automated matches [227016] (2 species)
    not a true protein
  7. 2151133Species Mycobacterium tuberculosis [TaxId:1773] [225761] (5 PDB entries)
  8. 2151139Domain d5kwja_: 5kwj A: [332456]
    automated match to d1sfra_
    complexed with 6y3

Details for d5kwja_

PDB Entry: 5kwj (more details), 2.01 Å

PDB Description: m.tb ag85c modified at c209 by amino-ebselen
PDB Compounds: (A:) Diacylglycerol acyltransferase/mycolyltransferase Ag85C

SCOPe Domain Sequences for d5kwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwja_ c.69.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d5kwja_:

Click to download the PDB-style file with coordinates for d5kwja_.
(The format of our PDB-style files is described here.)

Timeline for d5kwja_: