SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kwja_ (5kwj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134548Family c.69.1.3: Mycobacterial antigens [53491] (5 protein domains)
    automatically mapped to Pfam PF00756
  6. 2134569Protein automated matches [227016] (2 species)
    not a true protein
  7. 2134570Species Mycobacterium tuberculosis [TaxId:1773] [225761] (5 PDB entries)
  8. 2289155Domain d5kwja_: 5kwj A: [332456]
    automated match to d1sfra_
    complexed with 6y3

Details for d5kwja_

PDB Entry: 5kwj (more details), 2.01 Å

PDB Description: m.tb ag85c modified at c209 by amino-ebselen
PDB Compounds: (A:) Diacylglycerol acyltransferase/mycolyltransferase Ag85C

SCOPe Domain Sequences for d5kwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwja_ c.69.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d5kwja_:

Click to download the PDB-style file with coordinates for d5kwja_.
(The format of our PDB-style files is described here.)

Timeline for d5kwja_:

  • d5kwja_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30