SCOPe 2.06: Domain d5k39b2: 5k39 B:103-159

Lineage for d5k39b2 (5k39 B:103-159)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1249482] [332378] (1 PDB entry)

8. Domain d5k39b2: 5k39 B:103-159 [332379]
   Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b1
   automated match to d4u3sb2
   complexed with ca

Details for d5k39b2

PDB Entry: 5k39, 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum

PDB Compounds: (B:) Dockerin module from a protein of unknown function

SCOPe Domain Sequences for d5k39b2:

Sequence; same for both SEQRES and ATOM records:

>d5k39b2 a.139.1.0 (B:103-159) automated matches {Clostridium thermocellum [TaxId: 1249482]}
erkgvqdnainmvdvmeiskvfgtragdeeyvaeldlnmdgainlfdiaivirhfna

Timeline for d5k39b2:

• d5k39b2 is new in SCOPe 2.06-stable
  
• d5k39b2 appears in SCOPe 2.07
  
• d5k39b2 appears in the current release, SCOPe 2.08