Lineage for d5k39b2 (5k39 B:103-159)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012910Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2012911Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2012929Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2012930Protein automated matches [190928] (7 species)
    not a true protein
  7. 2289077Species Clostridium thermocellum [TaxId:1249482] [332378] (1 PDB entry)
  8. 2289078Domain d5k39b2: 5k39 B:103-159 [332379]
    Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b1
    automated match to d4u3sb2
    complexed with ca

Details for d5k39b2

PDB Entry: 5k39 (more details), 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum
PDB Compounds: (B:) Dockerin module from a protein of unknown function

SCOPe Domain Sequences for d5k39b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k39b2 a.139.1.0 (B:103-159) automated matches {Clostridium thermocellum [TaxId: 1249482]}
erkgvqdnainmvdvmeiskvfgtragdeeyvaeldlnmdgainlfdiaivirhfna

SCOPe Domain Coordinates for d5k39b2:

Click to download the PDB-style file with coordinates for d5k39b2.
(The format of our PDB-style files is described here.)

Timeline for d5k39b2:

  • d5k39b2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30