SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k39b2 (5k39 B:103-159)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012910Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. 2012911Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. 2012929Family a.139.1.0: automated matches [191542] (1 protein)
    not a true family
  6. 2012930Protein automated matches [190928] (7 species)
    not a true protein
  7. 2289077Species Clostridium thermocellum [TaxId:1249482] [332378] (1 PDB entry)
  8. 2289078Domain d5k39b2: 5k39 B:103-159 [332379]
    Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b1
    automated match to d4u3sb2
    complexed with ca

Details for d5k39b2

PDB Entry: 5k39 (more details), 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum
PDB Compounds: (B:) Dockerin module from a protein of unknown function

SCOPe Domain Sequences for d5k39b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k39b2 a.139.1.0 (B:103-159) automated matches {Clostridium thermocellum [TaxId: 1249482]}
erkgvqdnainmvdvmeiskvfgtragdeeyvaeldlnmdgainlfdiaivirhfna

SCOPe Domain Coordinates for d5k39b2:

Click to download the PDB-style file with coordinates for d5k39b2.
(The format of our PDB-style files is described here.)

Timeline for d5k39b2:

  • d5k39b2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30