SCOPe 2.06: Domain d5lhaa_: 5lha A:

Lineage for d5lhaa_ (5lha A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:306] [315480] (5 PDB entries)

8. Domain d5lhaa_: 5lha A: [331695]
   automated match to d3drda_
   complexed with pmp

Details for d5lhaa_

PDB Entry: 5lha, 1.89 Å

PDB Description: amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form

PDB Compounds: (A:) omega transaminase

SCOPe Domain Sequences for d5lhaa_:

Sequence; same for both SEQRES and ATOM records:

>d5lhaa_ c.67.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 306]}
ekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnr
asvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdaveta
lkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpw
lyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlr
evcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqri
adaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqpl
veryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkii
lsppltltrdeaglmvsaleaafarcg

Timeline for d5lhaa_:

• d5lhaa_ is new in SCOPe 2.06-stable
  
• d5lhaa_ appears in SCOPe 2.07
  
• d5lhaa_ appears in the current release, SCOPe 2.08