Lineage for d5gond1 (5gon D:1-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121690Protein automated matches [226837] (7 species)
    not a true protein
  7. 2121696Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)
  8. 2121846Domain d5gond1: 5gon D:1-245 [331612]
    Other proteins in same PDB: d5gona2, d5gonb2, d5gonc2, d5gond2, d5gone_, d5gonf1, d5gonf2
    automated match to d4drxb1
    complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg

Details for d5gond1

PDB Entry: 5gon (more details), 2.48 Å

PDB Description: structures of a beta-lactam bridged analogue in complex with tubulin
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5gond1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gond1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5gond1:

Click to download the PDB-style file with coordinates for d5gond1.
(The format of our PDB-style files is described here.)

Timeline for d5gond1: