SCOPe 2.06: Domain d5gonf1: 5gon F:1-76

Lineage for d5gonf1 (5gon F:1-76)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (51 PDB entries)

8. Domain d5gonf1: 5gon F:1-76 [331642]
   Other proteins in same PDB: d5gona1, d5gona2, d5gonb1, d5gonb2, d5gonc1, d5gonc2, d5gond1, d5gond2, d5gone_, d5gonf2
   automated match to d3tiia1
   complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg

Details for d5gonf1

PDB Entry: 5gon, 2.48 Å

PDB Description: structures of a beta-lactam bridged analogue in complex with tubulin

PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5gonf1:

Sequence; same for both SEQRES and ATOM records:

>d5gonf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5gonf1:

• d5gonf1 is new in SCOPe 2.06-stable
  
• d5gonf1 appears in SCOPe 2.07
  
• d5gonf1 appears in the current release, SCOPe 2.08